PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.395340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 341aa    MW: 38626.2 Da    PI: 8.4515
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.395340.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
   Cucsa.395340.1 14 KGPWSPEEDAKLKSYIEKHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.88.9e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.395340.1  69 GGFSEEEDRIICSLYVSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.813962IPR017930Myb domain
SuperFamilySSF466893.11E-2711109IPR009057Homeodomain-like
SMARTSM007173.8E-131364IPR001005SANT/Myb domain
PfamPF002493.9E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-251569IPR009057Homeodomain-like
CDDcd001671.32E-91662No hitNo description
PROSITE profilePS5129421.74963117IPR017930Myb domain
SMARTSM007175.7E-1167115IPR001005SANT/Myb domain
PfamPF002491.9E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2370117IPR009057Homeodomain-like
CDDcd001671.59E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKSYIE KHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDRIIC SLYVSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
QRKDHQQQAI TRRGNGVKQM QQMKRSSENN NATITTIAHM GENNSSIFSL NQSHNNNILP  180
YWPQQQHLPL APHFNSNLTP FGKPIIENDL SKFGVQFMDQ ESNLYSSNNN NNGNGNGNEY  240
GNYLPIMQGQ SSSSNSQMVE IENYNNMANY EDPRRVLCGL EFLYGDHHIM SGNNNDLQIS  300
SCLPNYEEIL LQDLSTTTTT TTQEYGAKFD DLRILDNNAL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143035.10.0PREDICTED: transcription factor RAX3-like
SwissprotQ9FKL23e-85MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0A0LR061e-109A0A0A0LR06_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g08470.t019e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-85myb domain protein 36